PDB entry 4q0x

View 4q0x on RCSB PDB site
Description: Crystal structure of non-neutralizing antibody in complex with Epitope II of HCV E2
Class: immune system/viral protein
Keywords: antibody, anti-HCV E2, HCV E2, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on 2014-04-02, released 2014-07-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Envelope glycoprotein E2
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: mAb 12 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Q0X (0-218)
  • Chain 'L':
    Compound: mAb 12 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4Q0X (0-217)
    Domains in SCOPe 2.06: d4q0xl1, d4q0xl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q0xL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhnngntyldwslqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne