PDB entry 4q0o

View 4q0o on RCSB PDB site
Description: Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand
Class: transcription
Keywords: pb1, polybromo 1 isoform 1, baf180, polybromo-1d, pbrm1, brg1-associated factor 180, bromodomain, chromatin regulator, DNA-binding, nucleus, transcription, transcription regulation, structural genomics consortium, sgc
Deposited on 2014-04-02, released 2014-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein polybromo-1
    Species: Homo sapiens [TaxId:9606]
    Gene: BAF180, PB1, PBRM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q0oa_
  • Heterogens: K, 2XC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4q0oA (A:)
smsgispkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikk
pmdmekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd
legd

    Sequence, based on observed residues (ATOM records): (download) 
    >4q0oA (A:)
skymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirs
hmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdlegd