PDB entry 4pz2

View 4pz2 on RCSB PDB site
Description: Structure of Zm ALDH2-6 (RF2F) in complex with NAD
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-03-28, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ZmALDH
    Species: Zea mays [TaxId:4577]
    Gene: ZEAMMB73_718272
    Database cross-references and differences (RAF-indexed):
    • Uniprot K7VEU7 (Start-533)
      • see remark 999 (68)
      • see remark 999 (127)
      • see remark 999 (129)
      • see remark 999 (368)
      • see remark 999 (405)
    Domains in SCOPe 2.07: d4pz2a_
  • Chain 'B':
    Compound: ZmALDH
    Species: Zea mays [TaxId:4577]
    Gene: ZEAMMB73_718272
    Database cross-references and differences (RAF-indexed):
    • Uniprot K7VEU7 (Start-533)
      • see remark 999 (68)
      • see remark 999 (127)
      • see remark 999 (129)
      • see remark 999 (368)
      • see remark 999 (405)
    Domains in SCOPe 2.07: d4pz2b_
  • Chain 'C':
    Compound: ZmALDH
    Species: Zea mays [TaxId:4577]
    Gene: ZEAMMB73_718272
    Database cross-references and differences (RAF-indexed):
    • Uniprot K7VEU7 (Start-533)
      • see remark 999 (68)
      • see remark 999 (127)
      • see remark 999 (129)
      • see remark 999 (368)
      • see remark 999 (405)
    Domains in SCOPe 2.07: d4pz2c_
  • Chain 'D':
    Compound: ZmALDH
    Species: Zea mays [TaxId:4577]
    Gene: ZEAMMB73_718272
    Database cross-references and differences (RAF-indexed):
    • Uniprot K7VEU7 (Start-533)
      • see remark 999 (68)
      • see remark 999 (127)
      • see remark 999 (129)
      • see remark 999 (368)
      • see remark 999 (405)
    Domains in SCOPe 2.07: d4pz2d_
  • Heterogens: NA, PEG, NAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pz2A (A:)
    gsshhhhhhsqdpnsmvsesnrggadrttaageekeergqllfdvpeirftklfingsfv
    davsgrtfdtrdprtggviasvaeadkedvdlavraaraafdhgewprmsgsergrimar
    ladlveehagelaalesldagkhpavtravdvgnaagslryfagaadkihgetlkmpgqf
    qghtlreplgvagviipwnfpstmfavkvapalaagcalvvkpaeqtplsalylaqlakq
    agvpdgvinvvpgfgptagaalashmdvdmvsftgstevgrlimkasaesnlkpvylelg
    gksplivfddadldmavelavgasffnkgeacvaasrvyvqervydrfeerlaermrswv
    vgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltggrpcapegkgyyieptvft
    nvkedmiiakeeifgpvmclmkfktveeaiarandtryglgagvvtrdldvanrvvrsvr
    agvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavksvvtplraspwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pz2A (A:)
    lfdvpeirftklfingsfvdavsgrtfdtrdprtggviasvaeadkedvdlavraaraaf
    dhgewprmsgsergrimarladlveehagelaalesldagkhpavtravdvgnaagslry
    fagaadkihgetlkmpgqfqghtlreplgvagviipwnfpstmfavkvapalaagcalvv
    kpaeqtplsalylaqlakqagvpdgvinvvpgfgptagaalashmdvdmvsftgstevgr
    limkasaesnlkpvylelggksplivfddadldmavelavgasffnkgeacvaasrvyvq
    ervydrfeerlaermrswvvgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltg
    grpcapkgyyieptvftnvkedmiiakeeifgpvmclmkfktveeaiarandtryglgag
    vvtrdldvanrvvrsvragvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavks
    vvtplraspwi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pz2B (B:)
    gsshhhhhhsqdpnsmvsesnrggadrttaageekeergqllfdvpeirftklfingsfv
    davsgrtfdtrdprtggviasvaeadkedvdlavraaraafdhgewprmsgsergrimar
    ladlveehagelaalesldagkhpavtravdvgnaagslryfagaadkihgetlkmpgqf
    qghtlreplgvagviipwnfpstmfavkvapalaagcalvvkpaeqtplsalylaqlakq
    agvpdgvinvvpgfgptagaalashmdvdmvsftgstevgrlimkasaesnlkpvylelg
    gksplivfddadldmavelavgasffnkgeacvaasrvyvqervydrfeerlaermrswv
    vgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltggrpcapegkgyyieptvft
    nvkedmiiakeeifgpvmclmkfktveeaiarandtryglgagvvtrdldvanrvvrsvr
    agvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavksvvtplraspwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pz2B (B:)
    llfdvpeirftklfingsfvdavsgrtfdtrdprtggviasvaeadkedvdlavraaraa
    fdhgewprmsgsergrimarladlveehagelaalesldagkhpavtravdvgnaagslr
    yfagaadkihgetlkmpgqfqghtlreplgvagviipwnfpstmfavkvapalaagcalv
    vkpaeqtplsalylaqlakqagvpdgvinvvpgfgptagaalashmdvdmvsftgstevg
    rlimkasaesnlkpvylelggksplivfddadldmavelavgasffnkgeacvaasrvyv
    qervydrfeerlaermrswvvgdpfsdpradqgpqvdkaqyervlsyidhgkregatllt
    ggrpcapegkgyyieptvftnvkedmiiakeeifgpvmclmkfktveeaiarandtrygl
    gagvvtrdldvanrvvrsvragvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkyla
    vksvvtplraspwi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pz2C (C:)
    gsshhhhhhsqdpnsmvsesnrggadrttaageekeergqllfdvpeirftklfingsfv
    davsgrtfdtrdprtggviasvaeadkedvdlavraaraafdhgewprmsgsergrimar
    ladlveehagelaalesldagkhpavtravdvgnaagslryfagaadkihgetlkmpgqf
    qghtlreplgvagviipwnfpstmfavkvapalaagcalvvkpaeqtplsalylaqlakq
    agvpdgvinvvpgfgptagaalashmdvdmvsftgstevgrlimkasaesnlkpvylelg
    gksplivfddadldmavelavgasffnkgeacvaasrvyvqervydrfeerlaermrswv
    vgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltggrpcapegkgyyieptvft
    nvkedmiiakeeifgpvmclmkfktveeaiarandtryglgagvvtrdldvanrvvrsvr
    agvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavksvvtplraspwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pz2C (C:)
    lfdvpeirftklfingsfvdavsgrtfdtrdprtggviasvaeadkedvdlavraaraaf
    dhgewprmsgsergrimarladlveehagelaalesldagkhpavtravdvgnaagslry
    fagaadkihgetlkmpgqfqghtlreplgvagviipwnfpstmfavkvapalaagcalvv
    kpaeqtplsalylaqlakqagvpdgvinvvpgfgptagaalashmdvdmvsftgstevgr
    limkasaesnlkpvylelggksplivfddadldmavelavgasffnkgeacvaasrvyvq
    ervydrfeerlaermrswvvgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltg
    grpcapkgyyieptvftnvkedmiiakeeifgpvmclmkfktveeaiarandtryglgag
    vvtrdldvanrvvrsvragvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavks
    vvtplraspwi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pz2D (D:)
    gsshhhhhhsqdpnsmvsesnrggadrttaageekeergqllfdvpeirftklfingsfv
    davsgrtfdtrdprtggviasvaeadkedvdlavraaraafdhgewprmsgsergrimar
    ladlveehagelaalesldagkhpavtravdvgnaagslryfagaadkihgetlkmpgqf
    qghtlreplgvagviipwnfpstmfavkvapalaagcalvvkpaeqtplsalylaqlakq
    agvpdgvinvvpgfgptagaalashmdvdmvsftgstevgrlimkasaesnlkpvylelg
    gksplivfddadldmavelavgasffnkgeacvaasrvyvqervydrfeerlaermrswv
    vgdpfsdpradqgpqvdkaqyervlsyidhgkregatlltggrpcapegkgyyieptvft
    nvkedmiiakeeifgpvmclmkfktveeaiarandtryglgagvvtrdldvanrvvrsvr
    agvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavksvvtplraspwi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pz2D (D:)
    llfdvpeirftklfingsfvdavsgrtfdtrdprtggviasvaeadkedvdlavraaraa
    fdhgewprmsgsergrimarladlveehagelaalesldagkhpavtravdvgnaagslr
    yfagaadkihgetlkmpgqfqghtlreplgvagviipwnfpstmfavkvapalaagcalv
    vkpaeqtplsalylaqlakqagvpdgvinvvpgfgptagaalashmdvdmvsftgstevg
    rlimkasaesnlkpvylelggksplivfddadldmavelavgasffnkgeacvaasrvyv
    qervydrfeerlaermrswvvgdpfsdpradqgpqvdkaqyervlsyidhgkregatllt
    ggrpcapgyyieptvftnvkedmiiakeeifgpvmclmkfktveeaiarandtryglgag
    vvtrdldvanrvvrsvragvvwvncyfamgsdcpfggrkmsgfgkdegmhaldkylavks
    vvtplraspwi