PDB entry 4pyl

View 4pyl on RCSB PDB site
Description: Humanized rat COMT in complex with sinefungin, Mg2+, and tolcapone
Class: transferase/transferase inhibitor
Keywords: METHYLTRANSFERASE, NEUROTRANSMITTER DEGRADATION, ALTERNATIVE INITIATION, CATECHOLAMINE METABOLISM, CELL MEMBRANE, MEMBRANE, METAL-BINDING, PHOSPHOPROTEIN, SIGNAL-ANCHOR, TRANSMEMBRANE ANCHOR, ENZYME MECHANISM, CONFORMATIONAL CHANGE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-03-27, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pyla_
  • Heterogens: MG, SFG, TCW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pylA (A:)
    mgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireysps
    lvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasq
    dlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfl
    ayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pylA (A:)
    tkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslvl
    elgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdli
    pqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflayv
    rgsssfecthyssyleymkvvdglekaiyqgps