PDB entry 4pyi

View 4pyi on RCSB PDB site
Description: human apo COMT
Class: transferase
Keywords: methyltransferase, neurotransmitter degradation, conformational change, catecholamine metabolism, cell membrane, membrane, metal-binding, signal-anchor, transferase
Deposited on 2014-03-27, released 2014-06-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: COMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pyia_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pyiA (A:)
    mgdtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkivdaviqehqps
    vllelgaycgysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasq
    diipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdfl
    ahvrgsscfecthyqsfleyrevvdglekaiykgpgseagp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pyiA (A:)
    tkeqrilnhvlqhaepgnaqsvleaidtyceqkgdkkgkivdaviqehqpsvllelgayc
    gysavrmarllspgarlitieinpdcaaitqrmvdfagvkdkvtlvvgasqdiipqlkkk
    ydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvicpgapdflahvrgsscf
    ecthyqsfleyrevvdglekaiykgpg