PDB entry 4pyg

View 4pyg on RCSB PDB site
Description: Transglutaminase2 complexed with GTP
Class: transferase
Keywords: Protein-GTP complex, Transglutaminase fold, Crosslinking, GTP binding, no modification, TRANSFERASE
Deposited on 2014-03-27, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (Start-686)
      • expression tag (687)
    Domains in SCOPe 2.07: d4pyga1, d4pyga2, d4pyga3, d4pyga4, d4pyga5
  • Chain 'B':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (Start-686)
      • expression tag (687)
    Domains in SCOPe 2.07: d4pygb1, d4pygb2, d4pygb3, d4pygb4, d4pygb5
  • Chain 'E':
    Compound: Protein-glutamine gamma-glutamyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (Start-686)
      • expression tag (687)
    Domains in SCOPe 2.07: d4pyge1, d4pyge2, d4pyge3, d4pyge4, d4pyge5
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pygA (A:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pygA (A:)
    elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
    gpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleast
    gyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipwnfg
    qfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdn
    nygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtnyns
    ahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldptpqe
    ksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrslivg
    lkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvgqsm
    nmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvp
    lcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrkl
    vaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhk
    lvvnfesdklkavkgfrnviigpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pygB (B:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pygB (B:)
    elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
    gpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleast
    gyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipwnfg
    qfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdn
    nygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtnyns
    ahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldptpqe
    ksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrslivg
    lkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvgqsm
    nmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvp
    lcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrkl
    vaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhk
    lvvnfesdklkavkgfrnviigpal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pygE (E:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmg
    lhklvvnfesdklkavkgfrnviigpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pygE (E:)
    elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
    gpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleast
    gyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipwnfg
    qfedgildiclilldvnpkflknagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdn
    nygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtnyns
    ahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldptpqe
    ksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrslivg
    lkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvgqsm
    nmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnlnlepfseksvp
    lcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqkrkl
    vaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdllplhmglhk
    lvvnfesdklkavkgfrnviigpal