PDB entry 4pxn

View 4pxn on RCSB PDB site
Description: Structure of Zm ALDH7 in complex with NAD
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-03-24, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0PHD8
      • see remark 999 (425)
    Domains in SCOPe 2.07: d4pxna_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0PHD8
      • see remark 999 (425)
    Domains in SCOPe 2.07: d4pxnb_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pxnA (A:)
    mgsshhhhhhsqdpnsmgafakeehqflaelglaqrnpgafacgawggsgptvtstsptn
    nqviaevveasvhdyeegmracfdaaktwmaipapkrgeivrqigdalraklhhlgrlvs
    lemgkilpegigevqeiidmcdyavglsrqlngsiipserpnhmmmevwnplgvvgvita
    fnfpcavlgwnacialvcgncvvwkgapttplitiamtkivasvleknnlpgaiftsfcg
    gteigqaialdiriplvsftgstraglmvqqqvsarfgkcllelsgnnaiivmddadiql
    avrsvlfaavgtagqrcttcrrlilheniyqtfldqlvevykqvrigdplekgtllgplh
    tpaskenflkgiqtiksqggkilfggsaiesegnfvqptiveitpsapvvkeelfgpvly
    vmkfqtlkeaieinnsvpqglsssiftkrpdiifkwlgphgsdcgivnvniptngaeigg
    afggekatgggreagsdswkqymrratctinygselplaqginfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pxnA (A:)
    keehqflaelglaqrnpgafacgawggsgptvtstsptnnqviaevveasvhdyeegmra
    cfdaaktwmaipapkrgeivrqigdalraklhhlgrlvslemgkilpegigevqeiidmc
    dyavglsrqlngsiipserpnhmmmevwnplgvvgvitafnfpcavlgwnacialvcgnc
    vvwkgapttplitiamtkivasvleknnlpgaiftsfcggteigqaialdiriplvsftg
    straglmvqqqvsarfgkcllelsgnnaiivmddadiqlavrsvlfaavgtagqrcttcr
    rlilheniyqtfldqlvevykqvrigdplekgtllgplhtpaskenflkgiqtiksqggk
    ilfggsaiesegnfvqptiveitpsapvvkeelfgpvlyvmkfqtlkeaieinnsvpqgl
    sssiftkrpdiifkwlgphgsdcgivnvniptngaeiggafggekatgggreagsdswkq
    ymrratctinygselpla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pxnB (B:)
    mgsshhhhhhsqdpnsmgafakeehqflaelglaqrnpgafacgawggsgptvtstsptn
    nqviaevveasvhdyeegmracfdaaktwmaipapkrgeivrqigdalraklhhlgrlvs
    lemgkilpegigevqeiidmcdyavglsrqlngsiipserpnhmmmevwnplgvvgvita
    fnfpcavlgwnacialvcgncvvwkgapttplitiamtkivasvleknnlpgaiftsfcg
    gteigqaialdiriplvsftgstraglmvqqqvsarfgkcllelsgnnaiivmddadiql
    avrsvlfaavgtagqrcttcrrlilheniyqtfldqlvevykqvrigdplekgtllgplh
    tpaskenflkgiqtiksqggkilfggsaiesegnfvqptiveitpsapvvkeelfgpvly
    vmkfqtlkeaieinnsvpqglsssiftkrpdiifkwlgphgsdcgivnvniptngaeigg
    afggekatgggreagsdswkqymrratctinygselplaqginfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pxnB (B:)
    keehqflaelglaqrnpgafacgawggsgptvtstsptnnqviaevveasvhdyeegmra
    cfdaaktwmaipapkrgeivrqigdalraklhhlgrlvslemgkilpegigevqeiidmc
    dyavglsrqlngsiipserpnhmmmevwnplgvvgvitafnfpcavlgwnacialvcgnc
    vvwkgapttplitiamtkivasvleknnlpgaiftsfcggteigqaialdiriplvsftg
    straglmvqqqvsarfgkcllelsgnnaiivmddadiqlavrsvlfaavgtagqrcttcr
    rlilheniyqtfldqlvevykqvrigdplekgtllgplhtpaskenflkgiqtiksqggk
    ilfggsaiesegnfvqptiveitpsapvvkeelfgpvlyvmkfqtlkeaieinnsvpqgl
    sssiftkrpdiifkwlgphgsdcgivnvniptngaeiggafggekatgggreagsdswkq
    ymrratctinygselpla