PDB entry 4pxl

View 4pxl on RCSB PDB site
Description: Structure of Zm ALDH2-3 (RF2C) in complex with NAD
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-03-24, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosolic aldehyde dehydrogenase RF2C
    Species: Zea mays [TaxId:4577]
    Gene: rf2c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8S531 (Start-516)
      • see remark 999 (71)
    Domains in SCOPe 2.07: d4pxla_
  • Chain 'B':
    Compound: Cytosolic aldehyde dehydrogenase RF2C
    Species: Zea mays [TaxId:4577]
    Gene: rf2c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8S531 (Start-516)
      • see remark 999 (71)
    Domains in SCOPe 2.07: d4pxlb_
  • Heterogens: NAD, EDO, PEG, NA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pxlA (A:)
    mgsshhhhhhsqdpnsatangsskgsfevpkvevrftklfidgkfvdavsgktfetrdpr
    tgeviasiaegdkadvdlavkaareafdngpwprmtgyergrilhrfadlidehveelaa
    ldtvdagklfavgkardipgaahllryyagaadkvhgatlkmaqrmhgytlkepvgvvgh
    ivpwnypttmfffkvgpalaagcavvvkpaeqtplsalfyahlareagvpagvlnvvpgf
    gptagaavaahmdvdkvsftgstevgrlvmraaaesnlkpvslelggkspvivfddadld
    mavnlvnfatytnkgeicvagtriyvqegiydefvkkaaelasksvvgdpfnpsvsqgpq
    vdkdqyekvlryidigkregatlvtggkpcgdkgyyieptiftdvkddmtiaqdeifgpv
    malmkfktveeviqkanntryglaagivtknidvantvsrsiragaiwincyfafdpdap
    fggykmsgfgkdmgmdaldkylqtktvvtplyntpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pxlA (A:)
    vevrftklfidgkfvdavsgktfetrdprtgeviasiaegdkadvdlavkaareafdngp
    wprmtgyergrilhrfadlidehveelaaldtvdagklfavgkardipgaahllryyaga
    adkvhgatlkmaqrmhgytlkepvgvvghivpwnypttmfffkvgpalaagcavvvkpae
    qtplsalfyahlareagvpagvlnvvpgfgptagaavaahmdvdkvsftgstevgrlvmr
    aaaesnlkpvslelggkspvivfddadldmavnlvnfatytnkgeicvagtriyvqegiy
    defvkkaaelasksvvgdpfnpsvsqgpqvdkdqyekvlryidigkregatlvtggkpcg
    dkgyyieptiftdvkddmtiaqdeifgpvmalmkfktveeviqkanntryglaagivtkn
    idvantvsrsiragaiwincyfafdpdapfggykmsgfgkdmgmdaldkylqtktvvtpl
    yntpwl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pxlB (B:)
    mgsshhhhhhsqdpnsatangsskgsfevpkvevrftklfidgkfvdavsgktfetrdpr
    tgeviasiaegdkadvdlavkaareafdngpwprmtgyergrilhrfadlidehveelaa
    ldtvdagklfavgkardipgaahllryyagaadkvhgatlkmaqrmhgytlkepvgvvgh
    ivpwnypttmfffkvgpalaagcavvvkpaeqtplsalfyahlareagvpagvlnvvpgf
    gptagaavaahmdvdkvsftgstevgrlvmraaaesnlkpvslelggkspvivfddadld
    mavnlvnfatytnkgeicvagtriyvqegiydefvkkaaelasksvvgdpfnpsvsqgpq
    vdkdqyekvlryidigkregatlvtggkpcgdkgyyieptiftdvkddmtiaqdeifgpv
    malmkfktveeviqkanntryglaagivtknidvantvsrsiragaiwincyfafdpdap
    fggykmsgfgkdmgmdaldkylqtktvvtplyntpwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pxlB (B:)
    vevrftklfidgkfvdavsgktfetrdprtgeviasiaegdkadvdlavkaareafdngp
    wprmtgyergrilhrfadlidehveelaaldtvdagklfavgkardipgaahllryyaga
    adkvhgatlkmaqrmhgytlkepvgvvghivpwnypttmfffkvgpalaagcavvvkpae
    qtplsalfyahlareagvpagvlnvvpgfgptagaavaahmdvdkvsftgstevgrlvmr
    aaaesnlkpvslelggkspvivfddadldmavnlvnfatytnkgeicvagtriyvqegiy
    defvkkaaelasksvvgdpfnpsvsqgpqvdkdqyekvlryidigkregatlvtggkpcg
    dkgyyieptiftdvkddmtiaqdeifgpvmalmkfktveeviqkanntryglaagivtkn
    idvantvsrsiragaiwincyfafdpdapfggykmsgfgkdmgmdaldkylqtktvvtpl
    yntpwl