PDB entry 4pt6

View 4pt6 on RCSB PDB site
Description: The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin with antibody-like affinities
Class: cell adhesion
Keywords: Integrin binding, Integrin, cell adhesion
Deposited on 2014-03-10, released 2015-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8, F8C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00451
      • expression tag (27-30)
      • expression tag (32)
      • conflict (81-82)
    Domains in SCOPe 2.06: d4pt6a_
  • Chain 'B':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8, F8C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00451
      • expression tag (27-30)
      • expression tag (32)
      • conflict (81-82)
    Domains in SCOPe 2.06: d4pt6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pt6A (A:)
    mlnscsmplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnpkew
    lqvdfqktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffqngkvkvfqgnqds
    ftpvvnsldpplltrylrihpqswvhqialrmevlgceaqdlyenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pt6A (A:)
    scsmplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnkewlqvd
    fqktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
    vnsldpplltrylrihpqswvhqialrmevlgce
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pt6B (B:)
    mlnscsmplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnpkew
    lqvdfqktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffqngkvkvfqgnqds
    ftpvvnsldpplltrylrihpqswvhqialrmevlgceaqdlyenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pt6B (B:)
    smplgmeskaisdaqitassyacrgdtcwspskarlhlqgrsnawrpqvnnpkewlqvdf
    qktmkvtgvttqgvksaatsmyvkeflisssqdghqwtlffngkvkvfqgnqdsftpvvn
    sldpplltrylrihpqswvhqialrmevlgcea