PDB entry 4pt5

View 4pt5 on RCSB PDB site
Description: Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
Class: hydrolase
Keywords: protease, mers-CoV, HYDROLASE
Deposited on 2014-03-10, released 2014-05-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain-like protease
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pt5a1, d4pt5a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pt5A (A:)
    gpqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslylad
    nltadetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavim
    tldllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakae
    lccsarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlve
    httpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvs
    ktsdwkckvtdvlfpgqkyssdcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pt5A (A:)
    ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
    adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
    llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
    sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
    pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
    dwkckvtdvlfpgqkyssdcn