PDB entry 4psb

View 4psb on RCSB PDB site
Description: Crystal Structure of Phytohormone Binding Protein from Vigna radiata in complex with gibberellic acid (GA3)
Class: plant protein
Keywords: Cytokinin Specific Binding Protein (CSBP), PR-10 FOLD, GIBBERELLIN, CYTOKININ, PLANT HORMONE BINDING, PLANT PROTEIN
Deposited on 2014-03-07, released 2014-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.154
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata [TaxId:157791]
    Gene: vrphbp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZWP8 (0-End)
      • conflict (91)
    Domains in SCOPe 2.06: d4psba_
  • Heterogens: GA3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4psbA (A:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4psbA (A:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsn