PDB entry 4ps9

View 4ps9 on RCSB PDB site
Description: Apo structure of Aldehyde Dehydrogenase from Bacillus cereus
Class: oxidoreductase
Keywords: Aldehyde dehydrogenase, Apo structure, Rossmann Fold, OXIDOREDUCTASE
Deposited on 2014-03-07, released 2015-03-11
Made obsolete by 5gt6 on 2017-09-06

The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ps9a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ps9b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ps9c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Bacillus cereus [TaxId:526980]
    Gene: bcere0002_25940
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ps9d_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ps9A (A:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ps9A (A:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ps9B (B:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ps9B (B:)
    ielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavka
    arsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatv
    enyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatg
    ctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgs
    tvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsr
    vfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatv
    aaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygl
    aagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnyte
    vksvwvnik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ps9C (C:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ps9C (C:)
    lkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavkaar
    safesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatven
    yryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatgct
    ivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgstv
    tgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsrvf
    vhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatvaa
    ggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssyglaa
    gvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnytevk
    svwvnik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ps9D (D:)
    mlktnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedid
    aavkaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvalddd
    isatvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmga
    alatgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkv
    aftgstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqnc
    sagsrvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkk
    egatvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierann
    ssyglaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyal
    dnytevksvwvnik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ps9D (D:)
    tnielkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaav
    kaarsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisa
    tvenyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaala
    tgctivlkpaeqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaft
    gstvtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsag
    srvfvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkega
    tvaaggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssy
    glaagvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldny
    tevksvwvnik