PDB entry 4ps6

View 4ps6 on RCSB PDB site
Description: Crystal structure of an inhibitor of vertebrate lysozyme (PA3902) from Pseudomonas aeruginosa PAO1 at 1.25 A resolution
Class: toxin
Keywords: PF08816 family, Ivy, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, TOXIN
Deposited on 2014-03-06, released 2014-04-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: inhibitor of vertebrate lysozyme
  Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
  Gene: ivy, PA3902
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HXB1 (1-129)
    • leader sequence (0)
  Domains in SCOPe 2.08: d4ps6a1, d4ps6a2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ps6A (A:)
  geeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansc
  kphdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellm
  kqlesdpnwk