PDB entry 4ps4

View 4ps4 on RCSB PDB site
Description: Crystal structure of the complex between IL-13 and M1295 FAB
Class: immune system
Keywords: immunoglobulin fold, alpha-helical bundle, cytokine, disulfide bond, glycoprotein, secreted, monoclonal antibody, immune system
Deposited on 2014-03-06, released 2014-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ps4a_
  • Chain 'H':
    Compound: m1295 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PS4 (0-End)
  • Chain 'L':
    Compound: m1295 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PS4 (0-212)
    Domains in SCOPe 2.07: d4ps4l1, d4ps4l2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ps4A (A:)
    mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
    ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ps4A (A:)
    pstalrelieelvnitqmycaaleslinvsgcsaiektqrmlsgfcphkvsatkievaqf
    vkdlllhlkklfregr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ps4L (L:)
    eivltqspatlslspgeratlscrasksiskylawyqqkpgqaprlliysgstlqsgipa
    rfsgsgsgtdftltisslepedfavyycqqhdypytfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec