PDB entry 4pro

View 4pro on RCSB PDB site
Description: alpha-lytic protease complexed with pro region
Deposited on 1998-10-01, released 1999-05-18
The last revision prior to the SCOP 1.65 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4proA (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4proB (B:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4proC (C:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4proC (C:)
    pqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklva
    atsgarksstlggvevrnvryslkqlqsameqldaganapldgvqswyvdprsnavvvkv
    ddgatdagvdfvalsgadsaqvriesspgklqtt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4proD (D:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4proD (D:)
    dpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklv
    aatsgarksstlggvevrnvryslkqlqsameqldaganarldgvqswyvdprsnavvvk
    vddgatdagvdfvalsgadsaqvriesspgklqtt