PDB entry 4prj

View 4prj on RCSB PDB site
Description: Aurora A kinase domain with compound 2 (N-[1-(3-cyanobenzyl)-1H-pyrazol-4-yl]-6-(1H-pyrazol-4-yl)-1H-indazole-3-carboxamide)
Class: transferase/transferase inhibitor
Keywords: protein kinase, phospho-transfer, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-03-05, released 2014-07-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (31)
      • engineered mutation (80)
      • engineered mutation (128)
      • engineered mutation (213)
    Domains in SCOPe 2.04: d4prja_
  • Heterogens: 2VU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4prjA (A:)
    makrqwaledfeigrplgkgkfgnvylareknskfilalkvlfkaqlekagvehqlrrev
    eiqshlrhpnilrlygyfhdstrvylileyaplgtvyrelqklskfdeqrtatyitelan
    alsychskkvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemie
    grmhdekvdlwslgvlcyeflvgkppfeantyqdtykrisrveftfpdfvtegardlisr
    llkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4prjA (A:)
    krqwaledfeigrplgkgnvylareknskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdstrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskkvihrdikpenlllgsagelkiadfgwsvcgtldylppemiegrmhdekvdlwslgv
    lcyeflvgkppfeantyqdtykrisrveftfpdfvtegardlisrllkhnpsqrpmlrev
    lehpwitanss