PDB entry 4prg

View 4prg on RCSB PDB site
Description: 0072 partial agonist ppar gamma cocrystal
Class: receptor
Keywords: thiazolidinone, ligand-binding domain, nuclear receptor, orphan receptor
Deposited on 1999-05-07, released 1999-05-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (peroxisome proliferator activated receptor gamma)
    Species: Homo sapiens [TaxId:9606]
    Gene: HPPARGAMMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4prga_
  • Chain 'B':
    Compound: protein (peroxisome proliferator activated receptor gamma)
    Species: Homo sapiens [TaxId:9606]
    Gene: HPPARGAMMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4prgb_
  • Chain 'C':
    Compound: protein (peroxisome proliferator activated receptor gamma)
    Species: Homo sapiens [TaxId:9606]
    Gene: HPPARGAMMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4prgc_
  • Chain 'D':
    Compound: protein (peroxisome proliferator activated receptor gamma)
    Species: Homo sapiens [TaxId:9606]
    Gene: HPPARGAMMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4prgd_
  • Heterogens: 072

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4prgA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4prgB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4prgC (C:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4prgD (D:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl