PDB entry 4prf

View 4prf on RCSB PDB site
Description: A Second Look at the HDV Ribozyme Structure and Dynamics.
Class: RNA binding protein/RNA
Keywords: HDV, ribozyme, RNA, U1A, precursor, TRANSLATION-RNA COMPLEX, RNA BINDING PROTEIN-RNA complex
Deposited on 2014-03-05, released 2014-10-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered mutation (30)
      • engineered mutation (35)
    Domains in SCOPe 2.05: d4prfa_
  • Chain 'B':
    Compound: Hepatitis Delta virus ribozyme
    Species: synthetic, synthetic
  • Heterogens: SR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4prfA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4prfA (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'B':
    No sequence available.