PDB entry 4pr6

View 4pr6 on RCSB PDB site
Description: A Second Look at the HDV Ribozyme Structure and Dynamics.
Class: RNA binding protein/RNA
Keywords: Base Sequence, Binding Sites, Catalysis, Cloning, Molecular, Computer Graphics, Escherichia coli, Hepatitis Delta Virus, Models, Molecular Sequence Data, Nucleic Acid Conformation, RNA, Catalytic, Viral, RNA-Binding Proteins, Ribonucleoprotein, U1 Small Nuclear, RNA BINDING PROTEIN/RNA, RNA BINDING PROTEIN-RNA complex
Deposited on 2014-03-05, released 2014-10-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-92)
      • engineered mutation (27)
      • engineered mutation (32)
      • expression tag (93-94)
    Domains in SCOPe 2.05: d4pr6a_
  • Chain 'B':
    Compound: hdv ribozyme self-cleaved
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pr6A (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakma
    

  • Chain 'B':
    No sequence available.