PDB entry 4pqe

View 4pqe on RCSB PDB site
Description: Crystal Structure of Human Acetylcholinesterase
Class: hydrolase
Keywords: Structural Genomics, Israel Structural Proteomics Center, ISPC, alpha/beta hydrolase, hydrolase
Deposited on 2014-03-02, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pqea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pqeA (A:)
    egredaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvv
    dattfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyg
    ggfysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlal
    qwvqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvg
    mgearrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfv
    pvvdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraefl
    agvrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaa
    qgarvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmryw
    anfartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkll
    sat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pqeA (A:)
    daellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdatt
    fqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggfy
    sgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwvq
    envaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmgea
    rrratqlahlvgcpndtelvaclrtrpaqvlvnhewhvlsvfrfsfvpvvdgdflsdtpe
    alinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgvpqvsdl
    aaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvyayvfehr
    astlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartgdpnepr
    dpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpklls