PDB entry 4pqc

View 4pqc on RCSB PDB site
Description: A sperm whale myoglobin single mutant F43H Mb with native His93 coordination
Class: oxygen transport
Keywords: Structural Genomics, Enzyme Function Initiative, alpha helix bundle, nitrite reductase, native state, OXYGEN TRANSPORT
Deposited on 2014-03-02, released 2015-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • engineered mutation (43)
    Domains in SCOPe 2.08: d4pqca_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4pqcA (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

    Sequence, based on observed residues (ATOM records): (download) 
    >4pqcA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg