PDB entry 4ppt

View 4ppt on RCSB PDB site
Description: Engineered Dual Specific VHH Antibody in Complex with a Nickel (II) Ion
Class: immune system
Keywords: Single domain antibody, VHH, Metalloregulation, Bispecific, Dual-Function, Protein Engineering, Affinity Control, Protein-Switch, Antibody Engineering, Nickel Binding Protein, Protein-Metal Coordination Geometry, Loop Dynamics, Protein Flexibility, Antibody-metal Complex, IMMUNE SYSTEM
Deposited on 2014-02-27, released 2014-09-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Engineered single domain VHH antibody
  Species: Lama glama [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 4PPT (0-120)
  Domains in SCOPe 2.08: d4ppta_
• Heterogens: NI, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pptA (A:)
  qvqlvesggglvqaggslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtly
  adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtyghwgqgtqvtvs
  s