PDB entry 4pou

View 4pou on RCSB PDB site
Description: VHH-metal in Complex with RNase A
Class: Hydrolase/Immune System
Keywords: Hydrolase/Immune System, Hydrolase-Immune System complex
Deposited on 2014-02-26, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4poua_
  • Chain 'B':
    Compound: VHH Antibody
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4POU (0-121)
    Domains in SCOPe 2.07: d4poub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pouA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pouA (A:)
    ketaaakferqhmdsstssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknva
    ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pouB (B:)
    qvqlvesggglvqagggslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtl
    yadsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyqlrdrtyghwgqgtqvtv
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pouB (B:)
    qvqlvesggglvqagslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtlya
    dsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyqlrdrtyghwgqgtqvtvss