PDB entry 4po5

View 4po5 on RCSB PDB site
Description: Crystal structure of allophycocyanin B from Synechocystis PCC 6803
Class: photosynthesis
Keywords: alpha-helical phycobiliprotein, light harvesting, phycocyanobilin, methylation on Asn71 in ApcB subunit, phycobilisome, PHOTOSYNTHESIS
Deposited on 2014-02-24, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.171
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Allophycocyanin subunit alpha-B
    Species: Synechocystis sp. [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72870 (Start-160)
      • expression tag (161-162)
    Domains in SCOPe 2.07: d4po5a1, d4po5a2
  • Chain 'B':
    Compound: allophycocyanin beta chain
    Species: Synechocystis sp. [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4po5b_
  • Chain 'C':
    Compound: Allophycocyanin subunit alpha-B
    Species: Synechocystis sp. [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72870 (Start-160)
      • expression tag (161-162)
    Domains in SCOPe 2.07: d4po5c1, d4po5c2
  • Chain 'D':
    Compound: allophycocyanin beta chain
    Species: Synechocystis sp. [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4po5d_
  • Chain 'E':
    Compound: Allophycocyanin subunit alpha-B
    Species: Synechocystis sp. [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72870 (Start-160)
      • expression tag (161-162)
    Domains in SCOPe 2.07: d4po5e1, d4po5e2
  • Chain 'F':
    Compound: allophycocyanin beta chain
    Species: Synechocystis sp. [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4po5f_
  • Heterogens: CYC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4po5A (A:)
    msvvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfk
    khpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynsln
    vpvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfmshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4po5A (A:)
    svvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfkk
    hpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynslnv
    pvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfmshh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4po5B (B:)
    mqdaitavinsadvqgkyldgaamdklksyfasgelrvraasvisanaativkeavaksl
    lysdvtrpggnmyttrryaacirdldyylryatyamlagdasildervlnglketynslg
    vpisstvqaiqaikevtaslvgadagkemgvyldyicsgls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4po5C (C:)
    msvvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfk
    khpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynsln
    vpvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfmshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4po5C (C:)
    svvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfkk
    hpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynslnv
    pvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfmshh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4po5D (D:)
    mqdaitavinsadvqgkyldgaamdklksyfasgelrvraasvisanaativkeavaksl
    lysdvtrpggnmyttrryaacirdldyylryatyamlagdasildervlnglketynslg
    vpisstvqaiqaikevtaslvgadagkemgvyldyicsgls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4po5E (E:)
    msvvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfk
    khpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynsln
    vpvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfmshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4po5E (E:)
    svvsqvilqaddqlryptsgelkgiqaflttgaqririaetlaenekkivdqaqkqlfkk
    hpeyrapggnaygqrqynqclrdygwylrlvtygvlagnkepiettgligvkemynslnv
    pvpgmvdavtvlkdaalgllsaedanetapyfdyiiqfmshh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4po5F (F:)
    mqdaitavinsadvqgkyldgaamdklksyfasgelrvraasvisanaativkeavaksl
    lysdvtrpggnmyttrryaacirdldyylryatyamlagdasildervlnglketynslg
    vpisstvqaiqaikevtaslvgadagkemgvyldyicsgls