PDB entry 4pnj

View 4pnj on RCSB PDB site
Description: Recombinant Sperm Whale P6 Myoglobin Solved with Single Pulse Free Electron Laser Data
Class: oxygen transport
Keywords: Myoglobin, Femtosecond X-ray Crystallography, OXYGEN TRANSPORT
Deposited on 2014-05-23, released 2014-11-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4pnja_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pnjA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg