PDB entry 4pn2

View 4pn2 on RCSB PDB site
Description: Crystal structure of GH10 endo-b-1,4-xylanase (XynB) from Xanthomonas axonopodis pv citri complexed with xylotriose
Class: hydrolase
Keywords: xylanase
Deposited on 2014-05-22, released 2014-10-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynB, XAC4254
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pn2a_
  • Chain 'B':
    Compound: xylanase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: xynB, XAC4254
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pn2b_
  • Heterogens: CA, XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pn2A (A:)
    aaplaataskflgcaygaqqapgfaqywnkltpenggkwgsveavrdqmdwstldaayrf
    aqanqmpfqmhvmvwgnqqpewiktlrpaeqrreieqwfaavaqrypdiallevvnepln
    dppskadtgggnylqalggngdsgwewvlqsfrlarrhfphtklmindysitssaqatqk
    ylqivrllqrenlvdaigvqehafettpevavsvhrdnldalaatglpiyitefdldgpt
    daqqladykrvfpvfwehpavhgitlwgfrpglwrdkeaayliradgterpaltwlrdyv
    aahpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pn2B (B:)
    aaplaataskflgcaygaqqapgfaqywnkltpenggkwgsveavrdqmdwstldaayrf
    aqanqmpfqmhvmvwgnqqpewiktlrpaeqrreieqwfaavaqrypdiallevvnepln
    dppskadtgggnylqalggngdsgwewvlqsfrlarrhfphtklmindysitssaqatqk
    ylqivrllqrenlvdaigvqehafettpevavsvhrdnldalaatglpiyitefdldgpt
    daqqladykrvfpvfwehpavhgitlwgfrpglwrdkeaayliradgterpaltwlrdyv
    aahpg