PDB entry 4pmd

View 4pmd on RCSB PDB site
Description: Crystal structure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose
Class: hydrolase
Keywords: GH10 family, xylanase, HYDROLASE
Deposited on 2014-05-21, released 2015-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Caldicellulosiruptor bescii [TaxId:521460]
    Gene: Athe_0185
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9MMA5 (Start-336)
      • engineered mutation (138)
      • expression tag (337)
    Domains in SCOPe 2.06: d4pmda1, d4pmda2
  • Heterogens: BXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pmdA (A:)
    msedyyekstvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihp
    kedfynfeatdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehi
    ktictryrdvvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklf
    yndynnempyklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslg
    leiqiteldisvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgis
    drhtwkdnfpvigrkdwpllfdidgkpkkaffriidfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pmdA (A:)
    tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea
    tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd
    vvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp
    yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld
    isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf
    pvigrkdwpllfdidgkpkkaffriidfl