PDB entry 4pm6

View 4pm6 on RCSB PDB site
Description: Crystal structure of CTX-M-14 S70G beta-lactamase at 1.56 Angstroms resolution
Class: hydrolase
Keywords: class A beta-lactamase
Deposited on 2014-05-20, released 2014-12-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.142
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase CTX-M-14
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:1125630]
    Gene: KPHS_p301310
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8XD06 (0-262)
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4pm6a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pm6A (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl