PDB entry 4pm5

View 4pm5 on RCSB PDB site
Description: Crystal structure of CTX-M-14 S70G beta-lactamase in complex with cefotaxime at 1.26 Angstroms resolution
Class: hydrolase/antibiotic
Keywords: Class A beta-lactamase, cefotaxime, HYDROLASE-ANTIBIOTIC complex
Deposited on 2014-05-20, released 2014-12-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase CTX-M-14
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:1125630]
    Gene: KPHS_p301310
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8XD06 (0-262)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4pm5a_
  • Heterogens: CE3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pm5A (A:)
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl