PDB entry 4plz

View 4plz on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum lactate dehydrogenase mutant W107fA.
Class: oxidoreductase
Keywords: Ancestral Sequence Reconstruction, Dehydrogenase, Apicomplexa, Specificity, OXIDOREDUCTASE
Deposited on 2014-05-20, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: LDH-P, LDH, ldh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.07: d4plza1, d4plza2, d4plza3
  • Heterogens: OXM, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4plzA (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkeanrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4plzA (A:)
    kakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckvsg
    sntyddlagadvvivtagfrddllplnnkimieigghikkncpnafiivvtnpvdvmvql
    lhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitv
    ggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlk
    kvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkal
    ah