PDB entry 4pjv

View 4pjv on RCSB PDB site
Description: Structure of PARP2 catalytic domain bound to inhibitor BMN 673
Class: transferase/transferase inhibitor
Keywords: PARP2, Inhibitor, Complex
Deposited on 2014-05-12, released 2014-09-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP2, ADPRT2, ADPRTL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (22)
      • see remark 999 (235)
    Domains in SCOPe 2.06: d4pjva1, d4pjva2, d4pjva3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP2, ADPRT2, ADPRTL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (22)
      • see remark 999 (235)
    Domains in SCOPe 2.06: d4pjvb1, d4pjvb2, d4pjvb3
  • Heterogens: 2YQ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pjvA (A:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pjvA (A:)
    mdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragr
    almeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkteehpldq
    hyrnlhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredl
    hnrmllwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlk
    ntgllllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgp
    asdtgilnpdgytlnyneyivynpnqvrmryllkvqfnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pjvB (B:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pjvB (B:)
    mdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciralm
    eacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkhpldqhyrnlh
    calrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrmll
    whgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntglll
    lsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdtgi
    lgytlnyneyivynpnqvrmryllkvqfnf