PDB entry 4pjj

View 4pjj on RCSB PDB site
Description: MYOSIN VI (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state - long soaking with PO4
Class: motor protein
Keywords: myosin vi, post-rigor state, mg.ADP.befx, calmodulin, molecular motor, motor protein
Deposited on 2014-05-12, released 2015-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Unconventional myosin-VI
    Species: Sus scrofa [TaxId:9823]
    Gene: MYO6
    Database cross-references and differences (RAF-indexed):
    • Uniprot F1RQI7
      • conflict (365)
  • Chain 'B':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Cam, CG8472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62152
      • conflict (128)
    Domains in SCOPe 2.07: d4pjjb_
  • Heterogens: ADP, MG, PO4, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pjjB (B:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemiresdidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pjjB (B:)
    dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
    tidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeev
    demiresdidgdgqvnyeefvtmmts