PDB entry 4pih

View 4pih on RCSB PDB site
Description: X-ray crystal structure of the K33S mutant of ubiquitin
Class: protein binding
Keywords: entropy-reduction, mutant, PROTEIN BINDING
Deposited on 2014-05-08, released 2014-10-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.168
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62987 (0-75)
      • engineered mutation (32)
    Domains in SCOPe 2.05: d4piha_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62987 (0-75)
      • engineered mutation (32)
    Domains in SCOPe 2.05: d4pihb_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pihA (A:)
    mqifvktltgktitlevepsdtienvkakiqdsegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pihB (B:)
    mqifvktltgktitlevepsdtienvkakiqdsegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg