PDB entry 4phh

View 4phh on RCSB PDB site
Description: Crystal structure of Ypt7 covalently modified with GNP
Class: Endocytosis,exocytosis
Keywords: Ypt7, acryl-nucleotides, aGNP, covalent, GNP, GppNHp, Endocytosis, exocytosis
Deposited on 2014-05-06, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein YPT7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YPT7, VAM4, YML001W, YM8270.02
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32939
      • engineered mutation (36)
    Domains in SCOPe 2.07: d4phha_
  • Chain 'B':
    Compound: GTP-binding protein YPT7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YPT7, VAM4, YML001W, YM8270.02
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32939 (Start-183)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d4phhb_
  • Chain 'C':
    Compound: GTP-binding protein YPT7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YPT7, VAM4, YML001W, YM8270.02
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32939 (Start-183)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d4phhc_
  • Chain 'D':
    Compound: GTP-binding protein YPT7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YPT7, VAM4, YML001W, YM8270.02
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32939 (Start-183)
      • engineered mutation (36)
    Domains in SCOPe 2.07: d4phhd_
  • Heterogens: 2UK, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4phhA (A:)
    ghmssrkknilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkva
    tmqvwdtagqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspet
    fpfvilgnkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalq
    qnqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4phhA (A:)
    ilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkvatmqvwdtag
    qerfqsvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkid
    aeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4phhB (B:)
    ghmssrkknilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkva
    tmqvwdtagqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspet
    fpfvilgnkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalq
    qnqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4phhB (B:)
    ilkviilgdsgvgktslmhryvndkyscatigadfltkevtvdgdkvatmqvwdtagqer
    fqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkida
    eeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4phhC (C:)
    ghmssrkknilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkva
    tmqvwdtagqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspet
    fpfvilgnkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalq
    qnqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4phhC (C:)
    ilkviilgdsgvgktslmhryvndkyscqykatigadfltkevvatmqvwdtagqerfqs
    lgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkidaees
    kkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4phhD (D:)
    ghmssrkknilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkva
    tmqvwdtagqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspet
    fpfvilgnkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalq
    qnqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4phhD (D:)
    nilkviilgdsgvgktslmhryvndkysckatigadfltkevtvatmqvwdtagqergva
    fyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkidaeeskkiv
    seksaqelakslgdiplfltsaknainvdtafeeiarsalqqnqa