PDB entry 4phg

View 4phg on RCSB PDB site
Description: Crystal structure of Ypt7 covalently modified with GTP
Class: Endocytosis,exocytosis
Keywords: Ypt7, acryl-nucleotides, aGTP, covalent, Endocytosis, exocytosis
Deposited on 2014-05-06, released 2014-05-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein YPT7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YPT7, VAM4, YML001W, YM8270.02
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32939
      • engineered mutation (36)
      • engineered mutation (39)
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4phga_
  • Heterogens: MG, 2UJ, YT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4phgA (A:)
    ghmssrkknilkviilgdsgvgktslmhryvndkyscqyiatigadfltkevtvdgdkva
    tmqvwdtaglerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspet
    fpfvilgnkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalq
    qnqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4phgA (A:)
    knilkviilgdsgvgktslmhryvndkyscqyiatigadfltkevtvdgdkvatmqvwdt
    aglerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilg
    nkidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq