PDB entry 4pgh

View 4pgh on RCSB PDB site
Description: Caffeic acid O-methyltransferase from Sorghum bicolor
Class: transferase
Keywords: SAM-dependent O-methyltransferase
Deposited on 2014-05-02, released 2014-07-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeic acid O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb07g003860, SORBIDRAFT_07g003860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pgha1, d4pgha2
  • Chain 'B':
    Compound: Caffeic acid O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb07g003860, SORBIDRAFT_07g003860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pghb1, d4pghb2
  • Chain 'C':
    Compound: Caffeic acid O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb07g003860, SORBIDRAFT_07g003860
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Caffeic acid O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb07g003860, SORBIDRAFT_07g003860
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pghA (A:)
    aedvaavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpv
    aptnpaaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpnedgvsmaal
    almnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfnegmknhsvii
    tkkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphviseappfpgvq
    hvggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivvecvlpvttd
    avpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanawaiefik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pghA (A:)
    aavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpvaptn
    paaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpnedgvsmaalalmn
    qdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfnegmknhsviitkkl
    lefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphviseappfpgvqhvgg
    dmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivvecvlpvttdavpk
    aqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanawaiefik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pghB (B:)
    aedvaavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpv
    aptnpaaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpnedgvsmaal
    almnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfnegmknhsvii
    tkkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphviseappfpgvq
    hvggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivvecvlpvttd
    avpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanawaiefik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pghB (B:)
    edvaavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpva
    ptnpaaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpnedgvsmaala
    lmnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfnegmknhsviit
    kkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphviseappfpgvqh
    vggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivvecvlpvttda
    vpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanawaiefik
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.