PDB entry 4pgg

View 4pgg on RCSB PDB site
Description: Caffeic acid O-methyltransferase from Sorghum bicolor
Class: transferase
Keywords: SAM-dependent O-methyltransferase
Deposited on 2014-05-01, released 2014-07-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeic acid O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb07g003860, SORBIDRAFT_07g003860
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5YH12 (1-359)
      • expression tag (0)
    Domains in SCOPe 2.04: d4pgga1, d4pgga2
  • Chain 'B':
    Compound: Caffeic acid O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb07g003860, SORBIDRAFT_07g003860
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5YH12 (1-359)
      • expression tag (0)
    Domains in SCOPe 2.04: d4pggb1, d4pggb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pggA (A:)
    ataedvaavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarl
    pvaptnpaaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpnedgvsma
    alalmnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfnegmknhsv
    iitkkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphviseappfpg
    vqhvggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivvecvlpvt
    tdavpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanawaiefik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pggB (B:)
    ataedvaavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarl
    pvaptnpaaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpnedgvsma
    alalmnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfnegmknhsv
    iitkkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphviseappfpg
    vqhvggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivvecvlpvt
    tdavpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanawaiefik