PDB entry 4pfs

View 4pfs on RCSB PDB site
Description: Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis
Class: ligase
Keywords: SSGCID, COBYRINIC ACID A, C-DIAMIDE SYNTHASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2014-04-30, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cobyrinic Acid a,c-diamide synthase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pfsa_
  • Chain 'B':
    Compound: Cobyrinic Acid a,c-diamide synthase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pfsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pfsA (A:)
    mahhhhhhmtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghd
    pdklpvsvhevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkrala
    kldgdfdvviidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitn
    pdlkllgalptlydsrtthsrdvlldvadryelpvlappiprtvrfaeasasgssvlagr
    kskgaiayrefadallrhwksgrkmptftpevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pfsA (A:)
    mtrvlavanqkgaktttvasigaalteqgrrvllvdldpqgcltfslghdpdklpvsvhe
    vllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkralakldgdfdvvi
    idcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitnpdlkllgalp
    tlydsrtthsrdvlldvadryelpvlappiprtrkskgaiayrefadallrhwksgrkmp
    tftpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pfsB (B:)
    mahhhhhhmtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghd
    pdklpvsvhevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkrala
    kldgdfdvviidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitn
    pdlkllgalptlydsrtthsrdvlldvadryelpvlappiprtvrfaeasasgssvlagr
    kskgaiayrefadallrhwksgrkmptftpevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pfsB (B:)
    mtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghdpdklpvsv
    hevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkralakldgdfdv
    viidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitnpdlkllga
    lptlydsrtthsrdvlldvadryelpvlappiprtkskgaiayrefadallrhwksgrkm
    ptftpe