PDB entry 4pf3

View 4pf3 on RCSB PDB site
Description: Mineralocorticoid receptor ligand-binding domain with compuond 37a
Class: transcription/transcription inhibitor
Keywords: nuclear receptor, transcription factor, hypertension, non-steroidal antagonist, activating mutation
Deposited on 2014-04-28, released 2014-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.155
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C2, MCR, MLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered mutation (98)
      • engineered mutation (100)
      • engineered mutation (266)
    Domains in SCOPe 2.06: d4pf3a_
  • Heterogens: HFN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pf3A (A:)
    gsapakepsvntalvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstl
    nrlagkqmiqvvkwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyf
    apdlvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksq
    aafeemrtnyikelrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfres
    halkvefpamlveiisdqlpkvesgnvkplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pf3A (A:)
    tpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlp
    ledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhq
    islqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkcpnns
    gqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesg
    nvkplyfhr