PDB entry 4per

View 4per on RCSB PDB site
Description: Structure of Gallus gallus ribonuclease inhibitor complexed with Gallus gallus ribonuclease I
Class: hydrolase/hydrolase inhibitor
Keywords: leucine-rich repeat, protein-protein complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-04-24, released 2014-06-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease inhibitor
    Species: Gallus gallus [TaxId:9031]
    Gene: RNH1, RCJMB04_22k18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZIY8 (4-459)
      • expression tag (0-3)
      • conflict (13)
    Domains in SCOPe 2.06: d4pera1, d4pera2
  • Chain 'B':
    Compound: angiogenin
    Species: Gallus gallus [TaxId:9031]
    Gene: ANG, RNaseA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4perb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4perA (A:)
    yfqgmdldiqceeinpsrwaellstmkscstirlddcnlsssnckdlssiihtnpslkel
    klnnnelgdagieylckglltpscslqklwlqncnltsascetlrsvlsaqpsltelhvg
    dnklgtagvkvlcqglmnpncklqklqleyceltadivealnaalqakptlkelslsnnt
    lgdtavkqlcrglveascdlellhlencgitsdscrdisavlsskpslldlavgdnkigd
    tglallcqgllhpnckiqklwlwdcdltsasckdlsrvfstketllevslidnnlrdsgm
    emlcqalkdpkahlqelwvrecgltaacckavssvlsvnkhlqvlhigenklgnagveil
    cegllhpncnihslwlgncditaaccatlanvmvtkqnlteldlsyntledegvmklcea
    vrnpnckmqqlilydifwgpevddelkaleearpdvkiis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4perA (A:)
    yfqgmdldiqceeinpsrwaellstmkscstirlddcnlsssnckdlssiihtnpslkel
    klnnnelgdagieylckglltpslqklwlqncnltsascetlrsvlsaqpsltelhvgdn
    klgtagvkvlcqglmnpncklqklqleyceltadivealnaalqakptlkelslsnntlg
    dtavkqlcrglveascdlellhlencgitsdscrdisavlsskpslldlavgdnkigdtg
    lallcqgllhpnckiqklwlwdcdltsasckdlsrvfstketllevslidnnlrdsgmem
    lcqalkdpkahlqelwvrecgltaacckavssvlsvnkhlqvlhigenklgnagveilce
    gllhpncnihslwlgncditaaccatlanvmvtkqnlteldlsyntledegvmklceavr
    npnckmqqlilydifwgpevddelkaleearpdvkiis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4perB (B:)
    ptyqdflrthvdfpktsfpniaaycnvmmvrrginvhgrckslntfvhtdprnlntlcin
    qpnralrttqqqlpvtdcklirshptcsytgnqfnhrvrvgcwgglpvhldgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4perB (B:)
    ptyqdflrthvdktsfpniaaycnvmmvrrginvhgrckslntfvhtdprnlntinqpnr
    alrttqqqlpvtdcklirshptcsytgnqfnhrvrvgcwgglpvhldgt