PDB entry 4peq

View 4peq on RCSB PDB site
Description: Structure of bovine ribonuclease inhibitor complexed with bovine ribonuclease I
Class: hydrolase/hydrolase inhibitor
Keywords: leucine-rich repeat, protein-protein complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-04-24, released 2014-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1, RNS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4peqa_
  • Chain 'B':
    Compound: Ribonuclease/angiogenin inhibitor 1
    Species: Bos taurus [TaxId:9913]
    Gene: RNH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4peqb_
  • Chain 'C':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1, RNS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4peqc_
  • Chain 'D':
    Compound: Ribonuclease/angiogenin inhibitor 1
    Species: Bos taurus [TaxId:9913]
    Gene: RNH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4peqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4peqA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4peqB (B:)
    mkldiqceqlsdarwtellpliqqyevvrlddcgltevrckdigsalqanasltelslrt
    nelgdggvllvlqglqsptckiqklslqncclteagcgvlpgvlrslptlrelhlsdnpl
    gdaglrllceglldprcrleklqleycsltaasceplaavlratrdlkelvvsnndigea
    gvqalcrglaesacqletlklencgltaanckdlcgivasqaslkdldlgsnrlgdagla
    elcpgllspssqlrtlwlwecdltvsgcrelcrvlqakealkelslagnslgdegaqllc
    esllqpgcqleslwvkscgftaaccqhfssmltqnkhllelqlssnplgdagvhvlcqal
    gqpgtvlrvlwvgdceltnsscgglaslllaspslreldlsnnglgdpgvlqllgsleqp
    acsleqlvlydiywteavderlraveeskpglriis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4peqB (B:)
    mkldiqceqlsdarwtellpliqqyevvrlddcgltevrckdigsalqanasltelslrt
    nelgdggvllvlqglqsptckiqklslqncclteagcgvlpgvlrslptlrelhlsdnpl
    gdaglrllceglldrleklqleycsltaasceplaavlratrdlkelvvsnndigeagvq
    alcrglaesacqletlklencgltaanckdlcgivasqaslkdldlgsnrlgdaglaelc
    pgllspssqlrtlwlwecdltvsgcrelcrvlqakealkelslagnslgdegaqllcesl
    lqpgcqleslwvkscgftaaccqhfssmltqnkhllelqlssnplgdagvhvlcqalgqp
    gtvlrvlwvgdceltnsscgglaslllaspslreldlsnnglgdpgvlqllgsleqpacs
    leqlvlydiywteavderlraveeskpglriis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4peqC (C:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4peqC (C:)
    etaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqk
    nvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfd
    asv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4peqD (D:)
    mkldiqceqlsdarwtellpliqqyevvrlddcgltevrckdigsalqanasltelslrt
    nelgdggvllvlqglqsptckiqklslqncclteagcgvlpgvlrslptlrelhlsdnpl
    gdaglrllceglldprcrleklqleycsltaasceplaavlratrdlkelvvsnndigea
    gvqalcrglaesacqletlklencgltaanckdlcgivasqaslkdldlgsnrlgdagla
    elcpgllspssqlrtlwlwecdltvsgcrelcrvlqakealkelslagnslgdegaqllc
    esllqpgcqleslwvkscgftaaccqhfssmltqnkhllelqlssnplgdagvhvlcqal
    gqpgtvlrvlwvgdceltnsscgglaslllaspslreldlsnnglgdpgvlqllgsleqp
    acsleqlvlydiywteavderlraveeskpglriis