PDB entry 4pd4

View 4pd4 on RCSB PDB site
Description: Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Class: oxidoreductase/inhibitor
Keywords: Cytochrome bc1 complex, Membrane protein complex, antimalarial drug, inhibitor, OXIDOREDUCTASE-INHIBITOR complex
Deposited on 2014-04-17, released 2014-06-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: 0.269
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b-c1 complex subunit 1, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07256 (0-430)
      • variant (126)
    Domains in SCOPe 2.04: d4pd4a1, d4pd4a2
  • Chain 'B':
    Compound: Cytochrome b-c1 complex subunit 2, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4b1, d4pd4b2
  • Chain 'C':
    Compound: cytochrome b
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4c1, d4pd4c2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4d1, d4pd4d2
  • Chain 'E':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4e1, d4pd4e2
  • Chain 'F':
    Compound: Cytochrome b-c1 complex subunit 6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4f_
  • Chain 'G':
    Compound: Cytochrome b-c1 complex subunit 7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4g_
  • Chain 'H':
    Compound: Cytochrome b-c1 complex subunit 8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4h_
  • Chain 'I':
    Compound: Cytochrome b-c1 complex subunit 9
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pd4i_
  • Chain 'J':
    Compound: Igh protein
    Species: Mus musculus [TaxId:10090]
    Gene: IGH
    Database cross-references and differences (RAF-indexed):
    • PDB 4PD4 (0-126)
    Domains in SCOPe 2.04: d4pd4j_
  • Chain 'K':
    Compound: Ig kappa chain V-V region HP 124E1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PD4 (0-106)
    Domains in SCOPe 2.04: d4pd4k_
  • Heterogens: UMQ, 3PH, HEM, AOQ, 3PE, UQ6, FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4A (A:)
    aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
    akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
    qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
    vvvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislave
    gepvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsg
    lwgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnd
    anllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldym
    rirsdmsmmrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4B (B:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4C (C:)
    mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
    afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
    filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
    alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
    alfvfyspntlghpdnyipgnplvtpasivpewyllpfyailrsipdkllgvitmfaail
    vllvlpftdrsvvrgntfkvlskffffifvfnfvllgqigachvevpyvlmgqiatfiyf
    ayfliivpvistienvlfyigrvnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4D (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkprk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4E (E:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4F (F:)
    vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
    ldtataprlfdklk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4G (G:)
    pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
    rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
    nievsk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4H (H:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4I (I:)
    sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4J (J:)
    evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
    npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
    ssawrhp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pd4K (K:)
    dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
    rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik