PDB entry 4pbt

View 4pbt on RCSB PDB site
Description: Crystal structure of the M. jannaschii G2 tRNA synthetase variant bound to 4-trans-cyclooctene-amidopheylalanine (Tco-amF)
Class: ligase
Keywords: tRNA synthetase, non-natural amino acid, LIGASE
Deposited on 2014-04-13, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (107-108)
      • engineered mutation (157)
      • engineered mutation (161)
      • expression tag (306-309)
    Domains in SCOPe 2.07: d4pbta1, d4pbta2
  • Heterogens: P4G, GOL, 2LQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pbtA (A:)
    mdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagf
    diiieladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsewmldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnsihykgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbtA (A:)
    mdefemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagf
    diiieladlhaylnqkgeldeirkigdynkkvfeamglkakyvygsewmldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnsihykgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehh