PDB entry 4pbc

View 4pbc on RCSB PDB site
Description: X-ray crystal structure of a putative D-amino acid aminotransferase from Burkholderia cenocepacia
Class: transferase
Keywords: Transferase D-amino acid Burkholderia cenocepacia, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2014-04-12, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid aminotransferase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL0705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pbca_
  • Chain 'B':
    Compound: d-amino acid aminotransferase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL0705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pbcb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pbcA (A:)
    mahhhhhhmsqaefepivylsvsaqeelvplsearvpvldrgfifgdgvyevvpvyahdg
    ahvpfrieqhldrlarslkkigidnphdaagwraliervvaanaeglgdgnalvylqvtr
    gvakrghafpanavptvfamtsplrlpseeerakgvrcvtaedrrwlhcdiksisllgnv
    lmaqhaaerdafetiqlrdenvtegsssnvwivkngelfapprsnkilegiryalveqla
    decgirfvareisevelrsadeimltsatkeilpvtslddlpvqggkpgpvfaalydayq
    rakarefeqfdltrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbcA (A:)
    epivylsvsaqeelvplsearvpvldrgfifgdgvyevvpvyahdgahvpfrieqhldrl
    arslkkigidnphdaagwraliervvaanaeglgdgnalvylqvtrgvakrghafpanav
    ptvfamtsplrlpseeerakgvrcvtaedrcdiksisllgnvlmaqhaaerdafetiqlr
    denvtegsssnvwivkngelfapprryalveqladecgirfvareisevelrsadeimlt
    satkeilpvtslddlpvqggkpgpvfaalydayqrakarefeqfdltr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pbcB (B:)
    mahhhhhhmsqaefepivylsvsaqeelvplsearvpvldrgfifgdgvyevvpvyahdg
    ahvpfrieqhldrlarslkkigidnphdaagwraliervvaanaeglgdgnalvylqvtr
    gvakrghafpanavptvfamtsplrlpseeerakgvrcvtaedrrwlhcdiksisllgnv
    lmaqhaaerdafetiqlrdenvtegsssnvwivkngelfapprsnkilegiryalveqla
    decgirfvareisevelrsadeimltsatkeilpvtslddlpvqggkpgpvfaalydayq
    rakarefeqfdltrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbcB (B:)
    fepivylsvsaqeelvplsearvpvldrgfifgdgvyevvpvyahdgahvpfrieqhldr
    larslkkigidnphdaagwraliervvaanaeglgdgnalvylqvtrgvakrghafpana
    vptvfamtsplrlpseeerakgvrcvtaedrdiksisllgnvlmaqhaaerdafetiqlr
    denvtegsssnvwivkngelfappryalveqladecgirfvareisevelrsadeimlts
    atkeilpvtslddlpvqggkpgpvfaalydayqrakarefeqfdltr