PDB entry 4pb0

View 4pb0 on RCSB PDB site
Description: Structure of the Fab fragment of the anti-Francisella tularensis GroEL antibody Ab53
Class: immune system
Keywords: antibody, immune system
Deposited on 2014-04-10, released 2014-07-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ab53 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PB0 (0-219)
  • Chain 'L':
    Compound: Ab53 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PB0 (0-215)
    Domains in SCOPe 2.04: d4pb0l1, d4pb0l2
  • Heterogens: SO4, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pb0L (L:)
dvvmtqspsslsvtigqpasisckssqslldsdggtylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgiyycwqgahfpytfgggtkleikradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnr