PDB entry 4pa1

View 4pa1 on RCSB PDB site
Description: Crystal Structure of Catalytic Core domain of FIV Integrase
Class: viral protein
Keywords: Retrovirus, FIV, Integrase
Deposited on 2014-04-07, released 2014-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.174
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Feline immunodeficiency virus [TaxId:11674]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16088 (2-150)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4pa1a1, d4pa1a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pa1A (A:)
    hmgiwqmdcthfdgkiilvgihvesgyiwaqiisqetadctvkavlqllsahnvtelqtd
    ngpnfknqkmegvlnymgvkhkfgipgnpqsqalvenvnhtlkvwiqkflpettsldnal
    slavhslnfkrrgriggmapyellaqqeslr