PDB entry 4p9a

View 4p9a on RCSB PDB site
Description: X-ray Crystal Structure of PA protein from Influenza strain H7N9
Class: viral protein
Keywords: PA protein Influenza H7N9 polymerase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Viral Protein
Deposited on 2014-04-02, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-20, with a file datestamp of 2014-08-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polymerase pa
    Species: Influenza A virus [TaxId:1322048]
    Gene: PA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p9aa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p9aA (A:)
    snariepflrttprplrlpngppcsqrskfllmdalklsiedpshegegiplydaikcmk
    tffgwkepniikphekginpnylltwkqvlaelqdieneekiprtknmkktsqlkwalge
    nmapekvdfedckdvndlkqynsdepeprslacwiqnefnkaceltdsswveldeigedv
    apiehiasmrrnyftaevshcrateyimkgvyintallnascaamddfqlipmiskcrtk
    egrrktnlygfiikgrshlrndtdvvnfvsmefsltdprlephkwekycvleigdmllrt
    avgqvsrpmflyvrtngtskikmkwgmemrrcllqslqqiesmieaessvkekdltkeff
    enksetwpigespkgveegsigkvcrtllaksvfnslyaspqlegfsaesrklllivqal
    rdnlepgtfdleglyeaieeclindpwvllnaswfnsflthalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p9aA (A:)
    rplrlpngppcsqrskfllmdalklsiedpegiplydaikcmktffgwkepniikphekg
    inpnylltwkqvlaelqdieneekiprtknmkktsqlkwalgepeprslacwiqnefnka
    celtdsswveldehiasmrrnyftaevshcrateyimkgvyintallnascaamddfqli
    pmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsltdprlephkwekycvl
    eigdmllrtavgqvsrpmflyvrtngtskikmkwgmemrrcllqslqqiesmieaeltke
    ffengsigkvcrtllaksvfnslyaspqlegfsaesrklllivqalrdntfdleglyeai
    eeclindpwvllnaswfnsflth