PDB entry 4p8s

View 4p8s on RCSB PDB site
Description: Crystal structure of Nogo-receptor-2
Class: membrane protein
Keywords: NOGO RECEPTOR, myelin associated glycoprotein, MEMBRANE PROTEIN
Deposited on 2014-04-01, released 2014-04-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reticulon-4 receptor-like 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rtn4rl2, Ngrh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p8sa_
  • Heterogens: NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4p8sA (A:)
pscpmlctcysspptvscqannfssvplslppstqrlflqnnlirslrpgtfgpnlltlw
lfsnnlstiypgtfrhlqaleeldlgdnrhlrslepdtfqglerlqslhlyrcqlsslpg
nifrglvslqylylqensllhlqddlfadlanlshlflhgnrlrlltehvfrglgsldrl
llhgnrlqgvhraafhglsrltilylfnnslaslpgealadlpaleflrlnanpwacdcr
arplwawfqrarvsssdvtcatpperqgrdlrtlrdtdfqac