PDB entry 4p8q

View 4p8q on RCSB PDB site
Description: Crystal Structure of Human Insulin Regulated Aminopeptidase with Alanine in Active Site
Class: hydrolase
Keywords: Aminopeptidase, Metallopeptidase, HYDROLASE
Deposited on 2014-03-31, released 2014-12-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.193
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucyl-cystinyl aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: LNPEP, OTASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4p8qa1, d4p8qa2, d4p8qa3, d4p8qa4
  • Chain 'B':
    Compound: Leucyl-cystinyl aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: LNPEP, OTASE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, NAG, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p8qA (A:)
    satngklfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstg
    hnisrvtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyyg
    fygfsytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpk
    kssvvlddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhya
    lettvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssma
    drklvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfld
    arfktmkkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavv
    lylhnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqe
    rfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvn
    inmngyyivhyadddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdli
    nylgnenhtapitealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegt
    psmrelrsallefacthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkg
    wsfllgkyisigseaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgr
    hfpghllawdfvkenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqsea
    tfrlrcvqealeviqlniqwmeknlksltwwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p8qA (A:)
    klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr
    vtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfs
    ytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvv
    lddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhyalettv
    klleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssmadrklv
    tkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfldarfkt
    mkkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavvlylhn
    hsyasiqsddlwdsfnevnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqerfflnm
    sdtsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvninmngyyivhya
    dddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapi
    tealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsalle
    facthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisig
    seaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfv
    kenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqeale
    viqlniqwmeknlksltwwl
    

  • Chain 'B':
    No sequence available.