PDB entry 4p8o

View 4p8o on RCSB PDB site
Description: S. aureus gyrase bound to an aminobenzimidazole urea inhibitor
Class: isomerase
Keywords: antibacterial, gram-positive, gyrase, topoisomerase, Staphylococcus aureus, ISOMERASE
Deposited on 2014-03-31, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:703339]
    Gene: gyrB, SAR0005
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p8oa_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:703339]
    Gene: gyrB, SAR0005
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p8ob_
  • Heterogens: 883, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p8oA (A:)
    megleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtd
    ngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
    vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
    dsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p8oA (A:)
    gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
    rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
    ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
    yhye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p8oB (B:)
    megleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtd
    ngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
    vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
    dsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p8oB (B:)
    gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
    rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
    ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
    yhye